PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn076051
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family Nin-like
Protein Properties Length: 412aa    MW: 47834.5 Da    PI: 9.9312
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn076051genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK83.42.2e-26260309352
      RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                 +++ ledl+kyF+lpi +A+k+L+v+lTvLK++CR++GI+RWPhRkiksl
  Achn076051 260 ARLALEDLAKYFDLPIVEASKNLKVGLTVLKKKCREFGIPRWPHRKIKSL 309
                 6899********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.723244330IPR003035RWP-RK domain
PfamPF020428.6E-22262309IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 412 aa     Download sequence    Send to blast
MASLQAYSLK ALVVFRNFMY PELIRTVHVY KLEDEGEKEV EREYLFRSNG DYEEIGTYKV  60
LTLEKFCPSA QFEGRVNGVW LCIYLFDADR HCPPNLEDIP TILSILRNPK LVSIPSLAND  120
LQIIFQLNHR TEDGEKLQVP PKETSVGKNA GGFQIENSLP SSSLDLNSFP YPELENEESD  180
KGSGYMQMPR GLNVQVKVSL VTPYKPFKSK DNKRLFLVYY ALYNAPVLGQ EQLALLIVRK  240
NWVSGLVEKR KKRAATKDIA RLALEDLAKY FDLPIVEASK NLKVGLTVLK KKCREFGIPR  300
WPHRKIKSLD SLIRDLQHAF VHAYIFTWKQ TRQVVMKKYL QAEVEQQQKA DEAAAMVVAK  360
RQRMLESEKE SIERKPFMEI QRETKKFRQD IFKKRHRART RDNQIRTMPL F*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A068U0G81e-119A0A068U0G8_COFCA; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1442579
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35590.14e-52RWP-RK domain-containing protein